Lineage for d4gy9a_ (4gy9 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1431002Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1431243Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1431528Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 1431529Protein automated matches [190218] (13 species)
    not a true protein
  7. 1431598Species Medicago truncatula [TaxId:3880] [194255] (5 PDB entries)
  8. 1431601Domain d4gy9a_: 4gy9 A: [227692]
    automated match to d4jhga_
    complexed with mli, na, zip

Details for d4gy9a_

PDB Entry: 4gy9 (more details), 2.04 Å

PDB Description: crystal structure of medicago truncatula nodulin 13 (mtn13) in complex with n6-isopentenyladenine (2ip)
PDB Compounds: (A:) MtN13 protein

SCOPe Domain Sequences for d4gy9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gy9a_ d.129.3.0 (A:) automated matches {Medicago truncatula [TaxId: 3880]}
idpftmgvitseseyvsslsaeklyrgivedgniiypkalprfiekaetlegdggpgtik
kltfvgdfgstkqhidmvdrencaytysvyegialsdqplekivfefklvptpeegcivk
sttkyytkgddielskdyleagierfegftkavesfllanpdy

SCOPe Domain Coordinates for d4gy9a_:

Click to download the PDB-style file with coordinates for d4gy9a_.
(The format of our PDB-style files is described here.)

Timeline for d4gy9a_:

  • d4gy9a_ appears in periodic updates to SCOPe 2.03 starting on 2013-12-06
  • d4gy9a_ appears in SCOPe 2.04
  • d4gy9a_ appears in the current release, SCOPe 2.07, called d4gy9a1