Lineage for d4gy9a1 (4gy9 A:1-158)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975504Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2975906Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2975907Protein automated matches [190218] (21 species)
    not a true protein
  7. 2976079Species Medicago truncatula [TaxId:3880] [194255] (8 PDB entries)
  8. 2976085Domain d4gy9a1: 4gy9 A:1-158 [227692]
    Other proteins in same PDB: d4gy9a2
    automated match to d4jhga_
    complexed with mli, na, zip

Details for d4gy9a1

PDB Entry: 4gy9 (more details), 2.04 Å

PDB Description: crystal structure of medicago truncatula nodulin 13 (mtn13) in complex with n6-isopentenyladenine (2ip)
PDB Compounds: (A:) MtN13 protein

SCOPe Domain Sequences for d4gy9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gy9a1 d.129.3.0 (A:1-158) automated matches {Medicago truncatula [TaxId: 3880]}
mgvitseseyvsslsaeklyrgivedgniiypkalprfiekaetlegdggpgtikkltfv
gdfgstkqhidmvdrencaytysvyegialsdqplekivfefklvptpeegcivksttky
ytkgddielskdyleagierfegftkavesfllanpdy

SCOPe Domain Coordinates for d4gy9a1:

Click to download the PDB-style file with coordinates for d4gy9a1.
(The format of our PDB-style files is described here.)

Timeline for d4gy9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4gy9a2