SCOPe 2.08: Domain d4gwra_: 4gwr A:

Lineage for d4gwra_ (4gwr A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188013] (113 PDB entries)

8. Domain d4gwra_: 4gwr A: [227687]
   automated match to d2e0qa_

Details for d4gwra_

PDB Entry: 4gwr, 1.81 Å

PDB Description: Crystal Structure of the second catalytic domain of protein disulfide isomerase P5

PDB Compounds: (A:) Protein disulfide-isomerase A6

SCOPe Domain Sequences for d4gwra_:

Sequence; same for both SEQRES and ATOM records:

>d4gwra_ c.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvieltddsfdknvldsedvwmvefyapwcghcknlepewaaaasevkeqtkgkvklaav
datvnqvlasrygirgfptikifqkgespvdydggrtrsdivsraldlfsdn

Timeline for d4gwra_:

• d4gwra_ first appeared in SCOPe 2.03
  
• d4gwra_ appears in SCOPe 2.07