Lineage for d4bnrb_ (4bnr B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2064431Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2065448Protein Trypsin(ogen) [50515] (9 species)
  7. 2065959Species Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId:6717] [141385] (2 PDB entries)
    Uniprot Q52V24 1-237
  8. 2065962Domain d4bnrb_: 4bnr B: [227680]
    Other proteins in same PDB: d4bnri_, d4bnrj_
    automated match to d2f91a1
    complexed with ca, so4

Details for d4bnrb_

PDB Entry: 4bnr (more details), 2 Å

PDB Description: extremely stable complex of crayfish trypsin with bovine trypsin inhibitor
PDB Compounds: (B:) hepatopancreas trypsin

SCOPe Domain Sequences for d4bnrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bnrb_ b.47.1.2 (B:) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]}
ivggtdatlgefpyqlsfqetfigfsfhfcgasiynenyaitaghcvygddyenpsglqi
vageldmsvnegseqiitvskiilhenfdynlldndisllklsgsltfndnvapialpeq
ghtatgdvivtgwgttseggntpdvlqkvtvplvsdedcradygadeildsmicagvpeg
gkdscqgdsggplaasdtgstylagivswgygcarpgypgvytevsyhvdwikanav

SCOPe Domain Coordinates for d4bnrb_:

Click to download the PDB-style file with coordinates for d4bnrb_.
(The format of our PDB-style files is described here.)

Timeline for d4bnrb_: