SCOPe 2.07: Domain d4bnra_: 4bnr A:

Lineage for d4bnra_ (4bnr A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId:6717] [141385] (2 PDB entries)
   Uniprot Q52V24 1-237

8. Domain d4bnra_: 4bnr A: [227679]
   Other proteins in same PDB: d4bnri_, d4bnrj_
   automated match to d2f91a1
   complexed with ca, so4

Details for d4bnra_

PDB Entry: 4bnr, 2 Å

PDB Description: extremely stable complex of crayfish trypsin with bovine trypsin inhibitor

PDB Compounds: (A:) hepatopancreas trypsin

SCOPe Domain Sequences for d4bnra_:

Sequence; same for both SEQRES and ATOM records:

>d4bnra_ b.47.1.2 (A:) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]}
ivggtdatlgefpyqlsfqetfigfsfhfcgasiynenyaitaghcvygddyenpsglqi
vageldmsvnegseqiitvskiilhenfdynlldndisllklsgsltfndnvapialpeq
ghtatgdvivtgwgttseggntpdvlqkvtvplvsdedcradygadeildsmicagvpeg
gkdscqgdsggplaasdtgstylagivswgygcarpgypgvytevsyhvdwikanav

Timeline for d4bnra_:

• d4bnra_ first appeared in SCOPe 2.03
  
• d4bnra_ appears in SCOPe 2.06
  
• d4bnra_ appears in the current release, SCOPe 2.08