Lineage for d4bjkb1 (4bjk B:32-478)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2006000Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [194968] (7 PDB entries)
  8. 2006022Domain d4bjkb1: 4bjk B:32-478 [227663]
    Other proteins in same PDB: d4bjka2, d4bjkb2, d4bjkc2, d4bjkd2
    automated match to d3khma_
    complexed with 18i, hem

Details for d4bjkb1

PDB Entry: 4bjk (more details), 2.67 Å

PDB Description: CYP51 of Trypanosoma brucei bound to (S)-N-(3-(1H-indol-3-yl)-1-oxo-1- (pyridin-4-ylamino)propan-2-yl)-3,3'-difluoro-(1,1'-biphenyl)-4- carboxamide
PDB Compounds: (B:) lanosterol 14-alpha-demethylase

SCOPe Domain Sequences for d4bjkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bjkb1 a.104.1.0 (B:32-478) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
ppmypvtvpilghiiqfgksplgfmqeckrqlksgiftinivgkrvtivgdphehsrffl
prnevlsprevysfmvpvfgegvayaapyprmreqlnflaeeltiakfqnfvpaiqhevr
kfmaanwdkdegeinlledcstmiintacqclfgedlrkrldarrfaqllakmesslipa
avflpillklplpqsarcheartelqkilseiiiarkaaavnkdsstsdllsgllsavyr
dgtpmslhevcgmivaamfagqhtssitttwsmlhlmhpanvkhlealrkeieefpaqln
ynnvmdempfaercaresirrdppllmlmrkvmadvkvgsyvvpkgdiiacspllshhde
eafpeprrwdperdekvegafigfgagvhkcigqkfgllqvktilatafrsydfqllrde
vpdpdyhtmvvgptasqcrvkyirrka

SCOPe Domain Coordinates for d4bjkb1:

Click to download the PDB-style file with coordinates for d4bjkb1.
(The format of our PDB-style files is described here.)

Timeline for d4bjkb1: