Lineage for d4bhla2 (4bhl A:96-356)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974757Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2974758Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2974891Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins)
    automatically mapped to Pfam PF00217
  6. 2974955Protein automated matches [226885] (7 species)
    not a true protein
  7. 2974977Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [227657] (3 PDB entries)
  8. 2974981Domain d4bhla2: 4bhl A:96-356 [227662]
    Other proteins in same PDB: d4bhla1
    automated match to d1m15a2
    complexed with arg, bme

Details for d4bhla2

PDB Entry: 4bhl (more details), 1.9 Å

PDB Description: crystal structure of litopenaeus vannamei arginine kinase in binary complex with arginine
PDB Compounds: (A:) arginine kinase

SCOPe Domain Sequences for d4bhla2:

Sequence, based on SEQRES records: (download)

>d4bhla2 d.128.1.2 (A:96-356) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
tdkhpnkdfgdvnsfvnvdpegkfvistrvrcgrsmqgypfnpcltesqykemeakvsst
lsslegelkgtyypltgmskevqqkliddhflfkegdrflqaanacrywpagrgiyhndn
ktflvwvneedhlriismqmggdlgqvfrrltsavneiekripfshhdrlgfltfcptnl
gttvrasvhiklpklaaneekleevagkynlqvrgtrgehteaeggiydisnkrrmglte
fqavkemedgilelikiekem

Sequence, based on observed residues (ATOM records): (download)

>d4bhla2 d.128.1.2 (A:96-356) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
tdkhpnkdfgdvnsfvnvdpegkfvistrvrcgrsmqgypfnpcltesqykemeakvsst
lsslegelkgtyypltgmskevqqkliddhflfkegdrflqaanacrywpagrgiyhndn
ktflvwvneedhlriismqmggdlgqvfrrltsavneiekripfshhdrlgfltfcptnl
gttvrasvhiklpklaaneekleevagkynlqvrgtggiydisnkrrmgltefqavkeme
dgilelikiekem

SCOPe Domain Coordinates for d4bhla2:

Click to download the PDB-style file with coordinates for d4bhla2.
(The format of our PDB-style files is described here.)

Timeline for d4bhla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bhla1