![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
![]() | Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) ![]() automatically mapped to Pfam PF02807 |
![]() | Family a.83.1.0: automated matches [227170] (1 protein) not a true family |
![]() | Protein automated matches [226884] (6 species) not a true protein |
![]() | Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [227655] (3 PDB entries) |
![]() | Domain d4bhla1: 4bhl A:1-95 [227661] Other proteins in same PDB: d4bhla2 automated match to d1m15a1 complexed with arg, bme |
PDB Entry: 4bhl (more details), 1.9 Å
SCOPe Domain Sequences for d4bhla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bhla1 a.83.1.0 (A:1-95) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]} madaaviekleagfkkleaatdcksllkkyltkevfdklkdkrtslgatlldviqsgven ldsgvgiyapdaeaytlfaplfdpiiedyhvgfkq
Timeline for d4bhla1: