Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) |
Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins) automatically mapped to Pfam PF00217 |
Protein automated matches [226885] (7 species) not a true protein |
Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [227657] (3 PDB entries) |
Domain d4bg4b2: 4bg4 B:96-356 [227660] Other proteins in same PDB: d4bg4a1, d4bg4b1 automated match to d1m15a2 complexed with adp, arg, bme, mg, no3 |
PDB Entry: 4bg4 (more details), 1.6 Å
SCOPe Domain Sequences for d4bg4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bg4b2 d.128.1.2 (B:96-356) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]} tdkhpnkdfgdvnsfvnvdpegkfvistrvrcgrsmqgypfnpcltesqykemeakvsst lsslegelkgtyypltgmskevqqkliddhflfkegdrflqaanacrywpagrgiyhndn ktflvwvneedhlriismqmggdlgqvfrrltsavneiekripfshhdrlgfltfcptnl gttvrasvhiklpklaanrekleevagkynlqvrgtrgehteaeggiydisnkrrmglte fqavkemqdgilelikiekem
Timeline for d4bg4b2: