Lineage for d4bg4b1 (4bg4 B:1-95)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1274810Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 1274811Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) (S)
    automatically mapped to Pfam PF02807
  5. 1274870Family a.83.1.0: automated matches [227170] (1 protein)
    not a true family
  6. 1274871Protein automated matches [226884] (5 species)
    not a true protein
  7. 1274891Species Litopenaeus vannamei [TaxId:6689] [227655] (3 PDB entries)
  8. 1274894Domain d4bg4b1: 4bg4 B:1-95 [227659]
    Other proteins in same PDB: d4bg4a2, d4bg4b2
    automated match to d1m15a1
    complexed with adp, arg, bme, mg, no3

Details for d4bg4b1

PDB Entry: 4bg4 (more details), 1.6 Å

PDB Description: crystal structure of litopenaeus vannamei arginine kinase in a ternary analog complex with arginine, adp-mg and no3
PDB Compounds: (B:) arginine kinase

SCOPe Domain Sequences for d4bg4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bg4b1 a.83.1.0 (B:1-95) automated matches {Litopenaeus vannamei [TaxId: 6689]}
madaaviekleagfkkleaatdcrsllkkyltkdvfdklkdkktslgatlldviqsgven
ldsgvgiyapdaeaytlfaplfdpiiedyhvgfkq

SCOPe Domain Coordinates for d4bg4b1:

Click to download the PDB-style file with coordinates for d4bg4b1.
(The format of our PDB-style files is described here.)

Timeline for d4bg4b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bg4b2