Class a: All alpha proteins [46456] (284 folds) |
Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) automatically mapped to Pfam PF02807 |
Family a.83.1.0: automated matches [227170] (1 protein) not a true family |
Protein automated matches [226884] (5 species) not a true protein |
Species Litopenaeus vannamei [TaxId:6689] [227655] (3 PDB entries) |
Domain d4bg4b1: 4bg4 B:1-95 [227659] Other proteins in same PDB: d4bg4a2, d4bg4b2 automated match to d1m15a1 complexed with adp, arg, bme, mg, no3 |
PDB Entry: 4bg4 (more details), 1.6 Å
SCOPe Domain Sequences for d4bg4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bg4b1 a.83.1.0 (B:1-95) automated matches {Litopenaeus vannamei [TaxId: 6689]} madaaviekleagfkkleaatdcrsllkkyltkdvfdklkdkktslgatlldviqsgven ldsgvgiyapdaeaytlfaplfdpiiedyhvgfkq
Timeline for d4bg4b1: