Lineage for d4bg4a2 (4bg4 A:96-356)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974757Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2974758Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2974891Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins)
    automatically mapped to Pfam PF00217
  6. 2974955Protein automated matches [226885] (7 species)
    not a true protein
  7. 2974977Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [227657] (3 PDB entries)
  8. 2974979Domain d4bg4a2: 4bg4 A:96-356 [227658]
    Other proteins in same PDB: d4bg4a1, d4bg4b1
    automated match to d1m15a2
    complexed with adp, arg, bme, mg, no3

Details for d4bg4a2

PDB Entry: 4bg4 (more details), 1.6 Å

PDB Description: crystal structure of litopenaeus vannamei arginine kinase in a ternary analog complex with arginine, adp-mg and no3
PDB Compounds: (A:) arginine kinase

SCOPe Domain Sequences for d4bg4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bg4a2 d.128.1.2 (A:96-356) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
tdkhpnkdfgdvnsfvnvdpegkfvistrvrcgrsmqgypfnpcltesqykemeakvsst
lsslegelkgtyypltgmskevqqkliddhflfkegdrflqaanscrywpagrgiyhndn
ktflvwvneedhlriismqmggdlgqvfrrltsavneiekripfshhdrlgfltfcptnl
gttvrasvhiklpklaanrekleevagkynlqvrgtrgehteaeggiydisnkrrmglte
fqavkemqdgilelikiekem

SCOPe Domain Coordinates for d4bg4a2:

Click to download the PDB-style file with coordinates for d4bg4a2.
(The format of our PDB-style files is described here.)

Timeline for d4bg4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bg4a1