SCOPe 2.08: Domain d4bg4a1: 4bg4 A:1-95

Lineage for d4bg4a1 (4bg4 A:1-95)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
   irregular array of 6 short helices

4. Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families)
   automatically mapped to Pfam PF02807

5. Family a.83.1.0: automated matches [227170] (1 protein)
   not a true family

6. Protein automated matches [226884] (9 species)
   not a true protein

7. Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [227655] (3 PDB entries)

8. Domain d4bg4a1: 4bg4 A:1-95 [227656]
   Other proteins in same PDB: d4bg4a2, d4bg4b2
   automated match to d1m15a1
   complexed with adp, arg, bme, mg, no3

Details for d4bg4a1

PDB Entry: 4bg4, 1.6 Å

PDB Description: crystal structure of litopenaeus vannamei arginine kinase in a ternary analog complex with arginine, adp-mg and no3

PDB Compounds: (A:) arginine kinase

SCOPe Domain Sequences for d4bg4a1:

Sequence; same for both SEQRES and ATOM records:

>d4bg4a1 a.83.1.0 (A:1-95) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
madaaviekleagfkkleaatdcksllkkyltkevfdklkdkktslgatlldviqsgven
ldsgvgiyapdaeaytlfaplfdpiiedyhvgfkq

Timeline for d4bg4a1:

• d4bg4a1 first appeared in SCOPe 2.03
  
• d4bg4a1 appears in SCOPe 2.07