SCOPe 2.08: Domain d2pcdq

Lineage for d2pcdq_ (2pcd Q:)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.3: Prealbumin-like [49451] (8 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strands to common fold
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families)
Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
sandwich; 9 strands in 2 sheets
Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
Species Pseudomonas putida [TaxId:303] [49490] (36 PDB entries)
Domain d2pcdq_: 2pcd Q: [22764]
Other proteins in same PDB: d2pcda_, d2pcdb_, d2pcdc_, d2pcdd_, d2pcde_, d2pcdf_
complexed with fe

Details for d2pcdq_

PDB Entry: 2pcd (more details), 2.15 Å

PDB Description: structure of protocatechuate 3,4-dioxygenase from pseudomonas aeruginosa at 2.15 angstroms resolution

PDB Compounds: (Q:) protocatechuate 3,4-dioxygenase (beta chain)

SCOPe Domain Sequences for d2pcdq_:

Sequence, based on SEQRES records: (download)

>d2pcdq_ b.3.6.1 (Q:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

Sequence, based on observed residues (ATOM records): (download)

>d2pcdq_ b.3.6.1 (Q:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapldpnf
ggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyfegd
plipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

SCOPe Domain Coordinates for d2pcdq_:

Click to download the PDB-style file with coordinates for d2pcdq_.
(The format of our PDB-style files is described here.)

Timeline for d2pcdq_: