Lineage for d3zhob_ (3zho B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2102350Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2102768Family c.23.5.8: WrbA-like [117474] (3 protein domains)
  6. 2102807Protein automated matches [190460] (2 species)
    not a true protein
  7. 2102808Species Escherichia coli [TaxId:405955] [193931] (2 PDB entries)
  8. 2102810Domain d3zhob_: 3zho B: [227633]
    automated match to d4dy4c_
    complexed with fmn

Details for d3zhob_

PDB Entry: 3zho (more details), 1.2 Å

PDB Description: X-ray structure of E.coli Wrba in complex with FMN at 1.2 A resolution
PDB Compounds: (B:) Flavoprotein WrbA

SCOPe Domain Sequences for d3zhob_:

Sequence, based on SEQRES records: (download)

>d3zhob_ c.23.5.8 (B:) automated matches {Escherichia coli [TaxId: 405955]}
akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapva
tpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqe
qtitstwttlahhgmvivpigyaaqelfdvsqvrggtpygattiaggdgsrqpsqeelsi
aryqgeyvaglavklng

Sequence, based on observed residues (ATOM records): (download)

>d3zhob_ c.23.5.8 (B:) automated matches {Escherichia coli [TaxId: 405955]}
akvlvlyysmyghietmaravaegaskvdgaevvvkrvpetmppqlfekaggktqtapva
tpqeladydaiifgtptrfgnmsgqmrtfldqtgglwasgalygklasvfsstgtgggqe
qtitstwttlahhgmvivpigygtpygattiagqpsqeelsiaryqgeyvaglavklng

SCOPe Domain Coordinates for d3zhob_:

Click to download the PDB-style file with coordinates for d3zhob_.
(The format of our PDB-style files is described here.)

Timeline for d3zhob_: