Lineage for d2ymzc_ (2ymz C:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1308833Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1308834Protein automated matches [190437] (23 species)
    not a true protein
  7. 1308928Species Gallus gallus [TaxId:9031] [227626] (1 PDB entry)
  8. 1308931Domain d2ymzc_: 2ymz C: [227632]
    automated match to d1hlca_
    complexed with lat, so4

Details for d2ymzc_

PDB Entry: 2ymz (more details), 1.75 Å

PDB Description: Crystal structure of chicken Galectin 2
PDB Compounds: (C:) galectin 2

SCOPe Domain Sequences for d2ymzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ymzc_ b.29.1.0 (C:) automated matches {Gallus gallus [TaxId: 9031]}
armfemfnldwksggtmkikghisedaesfainlgckssdlalhfnprfnesvivcnslc
sdnwqqeqrdkhfnfykgstvkiiveflgdkflvklpdghevefpnrhgydkisylnilg
gfkvtsfkve

SCOPe Domain Coordinates for d2ymzc_:

Click to download the PDB-style file with coordinates for d2ymzc_.
(The format of our PDB-style files is described here.)

Timeline for d2ymzc_:

  • d2ymzc_ appears in periodic updates to SCOPe 2.03 starting on 2013-12-06
  • d2ymzc_ appears in SCOPe 2.04
  • d2ymzc_ appears in the current release, SCOPe 2.07, called d2ymzc1