SCOPe 2.04: Domain d2ymzb_: 2ymz B:

Lineage for d2ymzb_ (2ymz B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (29 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [227626] (1 PDB entry)

8. Domain d2ymzb_: 2ymz B: [227631]
   automated match to d1hlca_
   complexed with lat, so4

Details for d2ymzb_

PDB Entry: 2ymz, 1.75 Å

PDB Description: crystal structure of chicken galectin 2

PDB Compounds: (B:) galectin 2

SCOPe Domain Sequences for d2ymzb_:

Sequence; same for both SEQRES and ATOM records:

>d2ymzb_ b.29.1.0 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
armfemfnldwksggtmkikghisedaesfainlgckssdlalhfnprfnesvivcnslc
sdnwqqeqrdkhfnfykgstvkiiveflgdkflvklpdghevefpnrhgydkisylnilg
gfkvtsfkve

Timeline for d2ymzb_:

• d2ymzb_ first appeared in SCOPe 2.03
  
• d2ymzb_ appears in SCOPe 2.05
  
• d2ymzb_ appears in the current release, SCOPe 2.08, called d2ymzb1