Lineage for d2ymze_ (2ymz E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781809Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1781810Protein automated matches [190437] (37 species)
    not a true protein
  7. 1781877Species Chicken (Gallus gallus) [TaxId:9031] [227626] (3 PDB entries)
  8. 1781883Domain d2ymze_: 2ymz E: [227628]
    automated match to d1hlca_
    complexed with lat, so4

Details for d2ymze_

PDB Entry: 2ymz (more details), 1.75 Å

PDB Description: Crystal structure of chicken Galectin 2
PDB Compounds: (E:) galectin 2

SCOPe Domain Sequences for d2ymze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ymze_ b.29.1.0 (E:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
armfemfnldwksggtmkikghisedaesfainlgckssdlalhfnprfnesvivcnslc
sdnwqqeqrdkhfnfykgstvkiiveflgdkflvklpdghevefpnrhgydkisylnilg
gfkvtsfkve

SCOPe Domain Coordinates for d2ymze_:

Click to download the PDB-style file with coordinates for d2ymze_.
(The format of our PDB-style files is described here.)

Timeline for d2ymze_: