| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins) lack the first helix (A) |
| Protein automated matches [190322] (4 species) not a true protein |
| Species Synechococcus sp. [TaxId:32049] [194261] (4 PDB entries) |
| Domain d4maxb_: 4max B: [227624] automated match to d4l2mb_ complexed with heb, so4 |
PDB Entry: 4max (more details), 1.44 Å
SCOPe Domain Sequences for d4maxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4maxb_ a.1.1.1 (B:) automated matches {Synechococcus sp. [TaxId: 32049]}
aslyeklggaaavdlavekfygkvladervnrffvntdmakqkqhqkdfmtyafggtdrf
pgrsmraahqdlvenagltdvhfdaiaenlvltlqelnvsqdlidevvtivgsvqhrndv
lnr
Timeline for d4maxb_: