SCOPe 2.07: Domain d4kzwb1: 4kzw B:79-211

Lineage for d4kzwb1 (4kzw B:79-211)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (19 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [227618] (6 PDB entries)

8. Domain d4kzwb1: 4kzw B:79-211 [227622]
   Other proteins in same PDB: d4kzwb2
   automated match to d3hupb_
   complexed with ca, flc, na

Details for d4kzwb1

PDB Entry: 4kzw, 1.85 Å

PDB Description: structure of the carbohydrate-recognition domain of the c-type lectin mincle

PDB Compounds: (B:) C-type lectin mincle

SCOPe Domain Sequences for d4kzwb1:

Sequence, based on SEQRES records:

>d4kzwb1 d.169.1.0 (B:79-211) automated matches {Cow (Bos taurus) [TaxId: 9913]}
cplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeqeflyytkprkkefyi
gltdqvtegqwqwvdgtpftkslsfwdagepnnlvtvedcatirdssnprqnwndvpcff
nmfrvcemperki

Sequence, based on observed residues (ATOM records):

>d4kzwb1 d.169.1.0 (B:79-211) automated matches {Cow (Bos taurus) [TaxId: 9913]}
cplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeqeflyytkprkkefyi
gltdqvtegqwqwvdgtpftkslsfwdagepnnvedcatirdssnprqnwndvpcffnmf
rvcemperki

Timeline for d4kzwb1:

• d4kzwb1 first appeared in SCOPe 2.03, called d4kzwb_
  
• d4kzwb1 appears in SCOPe 2.06