SCOPe 2.07: Domain d4kzvb1: 4kzv B:79-209

Lineage for d4kzvb1 (4kzv B:79-209)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (19 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [227618] (6 PDB entries)

8. Domain d4kzvb1: 4kzv B:79-209 [227621]
   Other proteins in same PDB: d4kzva2, d4kzvb2
   automated match to d3hupb_
   complexed with ca, na, tre

Details for d4kzvb1

PDB Entry: 4kzv, 1.4 Å

PDB Description: structure of the carbohydrate-recognition domain of the c-type lectin mincle bound to trehalose

PDB Compounds: (B:) C-type lectin mincle

SCOPe Domain Sequences for d4kzvb1:

Sequence, based on SEQRES records:

>d4kzvb1 d.169.1.0 (B:79-209) automated matches {Cow (Bos taurus) [TaxId: 9913]}
cplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeqeflyytkprkkefyi
gltdqvtegqwqwvdgtpftkslsfwdagepnnlvtvedcatirdssnprqnwndvpcff
nmfrvcemper

Sequence, based on observed residues (ATOM records):

>d4kzvb1 d.169.1.0 (B:79-209) automated matches {Cow (Bos taurus) [TaxId: 9913]}
cplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeqeflyytkprkkefyi
gltdqvtegqwqwvdgtpftkslsfwdagepnndcatirdssnprqnwndvpcffnmfrv
cemper

Timeline for d4kzvb1:

• d4kzvb1 first appeared in SCOPe 2.03, called d4kzvb_
  
• d4kzvb1 appears in SCOPe 2.06