Lineage for d4kzwa_ (4kzw A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559681Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2559682Protein automated matches [190159] (19 species)
    not a true protein
  7. 2559693Species Cow (Bos taurus) [TaxId:9913] [227618] (6 PDB entries)
  8. 2559697Domain d4kzwa_: 4kzw A: [227620]
    Other proteins in same PDB: d4kzwb2
    automated match to d3hupb_
    complexed with ca, flc, na

Details for d4kzwa_

PDB Entry: 4kzw (more details), 1.85 Å

PDB Description: structure of the carbohydrate-recognition domain of the c-type lectin mincle
PDB Compounds: (A:) C-type lectin mincle

SCOPe Domain Sequences for d4kzwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kzwa_ d.169.1.0 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
cplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeqeflyytkprkkefyi
gltdqvtegqwqwvdgtpftkslsfwdagepnnlvtvedcatirdssnprqnwndvpcff
nmfrvcemperki

SCOPe Domain Coordinates for d4kzwa_:

Click to download the PDB-style file with coordinates for d4kzwa_.
(The format of our PDB-style files is described here.)

Timeline for d4kzwa_: