SCOPe 2.03: Domain d4lstl2: 4lst L:108-216

Lineage for d4lstl2 (4lst L:108-216)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)

8. Domain d4lstl2: 4lst L:108-216 [227615]
   automated match to d3ngbk2
   complexed with nag

Details for d4lstl2

PDB Entry: 4lst, 2.55 Å

PDB Description: crystal structure of broadly and potently neutralizing antibody vrc01 in complex with hiv-1 clade c strain zm176.66 gp120

PDB Compounds: (L:) light chain of antibody vrc01

SCOPe Domain Sequences for d4lstl2:

Sequence; same for both SEQRES and ATOM records:

>d4lstl2 b.1.1.0 (L:108-216) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ikrtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvte
qdskdstyslsstltlskadyekhkvyacevthqglrspvtksfnrgec

Timeline for d4lstl2:

• d4lstl2 is new in SCOPe 2.03-stable
  
• d4lstl2 appears in SCOPe 2.04
  
• d4lstl2 appears in the current release, SCOPe 2.08