SCOPe 2.03: Domain d4jzel_: 4jze L:

Lineage for d4jzel_ (4jze L:)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein automated matches [190092] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187310] (65 PDB entries)

8. Domain d4jzel_: 4jze L: [227606]
   Other proteins in same PDB: d4jzeh_
   automated match to d1w7xl_
   complexed with 1nk, ca, gol, so4

Details for d4jzel_

PDB Entry: 4jze, 1.52 Å

PDB Description: Structure of factor VIIA in complex with the inhibitor 2-{2-[(1-aminoisoquinolin-6-yl)carbamoyl]-6-methoxypyridin-3-yl}-5-{[(2S)-1-hydroxy-3,3-dimethylbutan-2-yl]carbamoyl}benzoic acid

PDB Compounds: (L:) Factor VIIa (Light Chain)

SCOPe Domain Sequences for d4jzel_:

Sequence; same for both SEQRES and ATOM records:

>d4jzel_ g.3.11.1 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekr

Timeline for d4jzel_:

• d4jzel_ is new in SCOPe 2.03-stable
  
• d4jzel_ appears in SCOPe 2.04
  
• d4jzel_ appears in the current release, SCOPe 2.08