SCOPe 2.03: Domain d4iwwb_: 4iww B:

Lineage for d4iwwb_ (4iww B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)

6. Protein automated matches [190053] (8 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [190005] (6 PDB entries)

8. Domain d4iwwb_: 4iww B: [227604]
   automated match to d4ix0a_
   complexed with co, so4

Details for d4iwwb_

PDB Entry: 4iww, 2.3 Å

PDB Description: Computational Design of an Unnatural Amino Acid Metalloprotein with Atomic Level Accuracy

PDB Compounds: (B:) Unnatural Amino Acid Mediated Metalloprotein

SCOPe Domain Sequences for d4iwwb_:

Sequence; same for both SEQRES and ATOM records:

>d4iwwb_ c.1.2.4 (B:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
prylkgwledvvqlslrrpsvrasrqrpiislnerilefnkrnitaiiaeykrkspsgld
verdpieyakfmeryavglsilteekyfngsyetlrkiassvsipilmmdfivkesqidd
aynlgadtvllxvkiltereleslleyarsygmeplieitdendldialrigarfigiss
qddetleinkenqrklismipsnvvkvadsgiserneieelrklgvnafligsslmrnpe
kikelil

Timeline for d4iwwb_:

• d4iwwb_ is new in SCOPe 2.03-stable
  
• d4iwwb_ appears in SCOPe 2.04
  
• d4iwwb_ appears in the current release, SCOPe 2.08