SCOPe 2.06: Domain d4kwec2: 4kwe C:206-312

Lineage for d4kwec2 (4kwe C:206-312)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)

6. Protein Cell-division protein FtsZ [55309] (9 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [111032] (6 PDB entries)
   Uniprot O08378

8. Domain d4kwec2: 4kwe C:206-312 [227591]
   Other proteins in same PDB: d4kwea1, d4kweb1, d4kwec1
   automated match to d1rq2a2
   complexed with gdp

Details for d4kwec2

PDB Entry: 4kwe, 2.91 Å

PDB Description: GDP-bound, double-stranded, curved FtsZ protofilament structure

PDB Compounds: (C:) cell division protein ftsz

SCOPe Domain Sequences for d4kwec2:

Sequence; same for both SEQRES and ATOM records:

>d4kwec2 d.79.2.1 (C:206-312) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
vdfadvkgimsgagtalmgigsargegrslkaaeiainsplleasmegaqgvlmsiaggs
dlglfeineaaslvqdaahpdaniifgtviddslgdevrvtviaagf

Timeline for d4kwec2:

• d4kwec2 first appeared in SCOPe 2.03
  
• d4kwec2 appears in SCOPe 2.05
  
• d4kwec2 appears in SCOPe 2.07
  
• d4kwec2 appears in the current release, SCOPe 2.08