Lineage for d4kwea2 (4kwe A:206-312)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1420571Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1420831Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 1420832Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 1420833Protein Cell-division protein FtsZ [55309] (9 species)
  7. 1420864Species Mycobacterium tuberculosis [TaxId:1773] [111032] (6 PDB entries)
    Uniprot O08378
  8. 1420875Domain d4kwea2: 4kwe A:206-312 [227589]
    Other proteins in same PDB: d4kwea1, d4kweb1, d4kwec1
    automated match to d1rq2a2
    complexed with gdp

Details for d4kwea2

PDB Entry: 4kwe (more details), 2.91 Å

PDB Description: GDP-bound, double-stranded, curved FtsZ protofilament structure
PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d4kwea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kwea2 d.79.2.1 (A:206-312) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
vdfadvkgimsgagtalmgigsargegrslkaaeiainsplleasmegaqgvlmsiaggs
dlglfeineaaslvqdaahpdaniifgtviddslgdevrvtviaagf

SCOPe Domain Coordinates for d4kwea2:

Click to download the PDB-style file with coordinates for d4kwea2.
(The format of our PDB-style files is described here.)

Timeline for d4kwea2: