| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) ![]() |
| Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins) |
| Protein Cell-division protein FtsZ [55309] (9 species) |
| Species Mycobacterium tuberculosis [TaxId:1773] [111032] (6 PDB entries) Uniprot O08378 |
| Domain d4kwea2: 4kwe A:206-312 [227589] Other proteins in same PDB: d4kwea1, d4kweb1, d4kwec1 automated match to d1rq2a2 complexed with gdp |
PDB Entry: 4kwe (more details), 2.91 Å
SCOPe Domain Sequences for d4kwea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kwea2 d.79.2.1 (A:206-312) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
vdfadvkgimsgagtalmgigsargegrslkaaeiainsplleasmegaqgvlmsiaggs
dlglfeineaaslvqdaahpdaniifgtviddslgdevrvtviaagf
Timeline for d4kwea2:
View in 3DDomains from other chains: (mouse over for more information) d4kweb1, d4kweb2, d4kwec1, d4kwec2 |