SCOPe 2.03: Domain d4kwea1: 4kwe A:8-205

Lineage for d4kwea1 (4kwe A:8-205)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)

6. Protein Cell-division protein FtsZ [52492] (9 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [110501] (6 PDB entries)
   Uniprot O08378

8. Domain d4kwea1: 4kwe A:8-205 [227588]
   Other proteins in same PDB: d4kwea2, d4kweb2, d4kwec2
   automated match to d1rq2a1
   complexed with gdp

Details for d4kwea1

PDB Entry: 4kwe, 2.91 Å

PDB Description: GDP-bound, double-stranded, curved FtsZ protofilament structure

PDB Compounds: (A:) cell division protein ftsz

SCOPe Domain Sequences for d4kwea1:

Sequence; same for both SEQRES and ATOM records:

>d4kwea1 c.32.1.1 (A:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgrdstrglg
agadpevgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvg
vvtrpfsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslmdafrsadevl
lngvqgitdlittpglin

Timeline for d4kwea1:

• d4kwea1 is new in SCOPe 2.03-stable
  
• d4kwea1 appears in SCOPe 2.04
  
• d4kwea1 appears in the current release, SCOPe 2.08