Lineage for d4kweb1 (4kwe B:8-205)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2863166Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2863167Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2863168Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2863169Protein Cell-division protein FtsZ [52492] (9 species)
  7. 2863200Species Mycobacterium tuberculosis [TaxId:1773] [110501] (6 PDB entries)
    Uniprot O08378
  8. 2863210Domain d4kweb1: 4kwe B:8-205 [227586]
    Other proteins in same PDB: d4kwea2, d4kweb2, d4kwec2
    automated match to d1rq2a1
    complexed with gdp

Details for d4kweb1

PDB Entry: 4kwe (more details), 2.91 Å

PDB Description: GDP-bound, double-stranded, curved FtsZ protofilament structure
PDB Compounds: (B:) cell division protein ftsz

SCOPe Domain Sequences for d4kweb1:

Sequence, based on SEQRES records: (download)

>d4kweb1 c.32.1.1 (B:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgrdstrglg
agadpevgrkaaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvg
vvtrpfsfegkrrsnqaengiaalrescdtlivipndrllqmgdaavslmdafrsadevl
lngvqgitdlittpglin

Sequence, based on observed residues (ATOM records): (download)

>d4kweb1 c.32.1.1 (B:8-205) Cell-division protein FtsZ {Mycobacterium tuberculosis [TaxId: 1773]}
lavikvvgiggggvnavnrmieqglkgvefiaintdaqallmsdadvkldvgadpevgrk
aaedakdeieellrgadmvfvtagegggtgtggapvvasiarklgaltvgvvtrpfsfeg
krrsnqaengiaalrescdtlivipndrllqmgdaavslmdafrsadevllngvqgitdl
ittpglin

SCOPe Domain Coordinates for d4kweb1:

Click to download the PDB-style file with coordinates for d4kweb1.
(The format of our PDB-style files is described here.)

Timeline for d4kweb1: