SCOPe 2.03: Domain d4kcda_: 4kcd A:

Lineage for d4kcda_ (4kcd A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (57 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (69 PDB entries)

8. Domain d4kcda_: 4kcd A: [227583]
   automated match to d2rc9b_
   complexed with gol

Details for d4kcda_

PDB Entry: 4kcd, 1.68 Å

PDB Description: crystal structure of the nmda receptor glun3a ligand binding domain apo state

PDB Compounds: (A:) Glutamate receptor ionotropic, NMDA 3A

SCOPe Domain Sequences for d4kcda_:

Sequence; same for both SEQRES and ATOM records:

>d4kcda_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nklhlrvvtliehpfvftrevddeglcpagqlcldpmtndssmldrlfsslhssndtvpi
kfkkccygycidlleqlaedmnfdfdlyivgdgkygawknghwtglvgdllsgtanmavt
sfsintarsqvidftspffstslgilvrtrgtelsgihdpklhhpsqgfrfgtvressae
dyvrqsfpemheymrrynvpatpdgvqylkndpekldafimdkalldyevsidadckllt
vgkpfaiegygiglppnspltsniselisqykshgfmdvlhdkwykvvpc

Timeline for d4kcda_:

• d4kcda_ is new in SCOPe 2.03-stable
  
• d4kcda_ appears in SCOPe 2.04
  
• d4kcda_ appears in the current release, SCOPe 2.08