SCOPe 2.03: Domain d4k19b_: 4k19 B:

Lineage for d4k19b_ (4k19 B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Neutrophil gelatinase-associated lipocalin (NGAL) [50835] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50836] (28 PDB entries)

8. Domain d4k19b_: 4k19 B: [227581]
   automated match to d1l6ma_
   complexed with 1od, cl, fe, gol, na, so4

Details for d4k19b_

PDB Entry: 4k19, 2.74 Å

PDB Description: the structure of human siderocalin bound to the bacterial siderophore fluvibactin

PDB Compounds: (B:) Neutrophil gelatinase-associated lipocalin

SCOPe Domain Sequences for d4k19b_:

Sequence, based on SEQRES records:

>d4k19b_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
sdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelkedksy
nvtsvlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnynqhamvffk
kvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqci

Sequence, based on observed residues (ATOM records):

>d4k19b_ b.60.1.1 (B:) Neutrophil gelatinase-associated lipocalin (NGAL) {Human (Homo sapiens) [TaxId: 9606]}
sdlipapplskvplqqnfqdnqfqgkwyvvglanailredkpqkmyatiyeldksynvts
vlfrkkkcdywirtfvpgsqpgeftlgniksypgltsylvrvvstnqhamvffkkvsqnr
eyfkitlygrtkeltkenfirfskslglpenhivfpvpidqci

Timeline for d4k19b_:

• d4k19b_ is new in SCOPe 2.03-stable
  
• d4k19b_ appears in SCOPe 2.04
  
• d4k19b_ appears in the current release, SCOPe 2.08