Lineage for d4dhna1 (4dhn A:1-231)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007216Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2007217Family a.118.7.1: 14-3-3 protein [48446] (5 protein domains)
  6. 2007267Protein automated matches [190238] (9 species)
    not a true protein
  7. 2007276Species Human (Homo sapiens) [TaxId:9606] [187008] (42 PDB entries)
  8. 2007296Domain d4dhna1: 4dhn A:1-231 [227565]
    Other proteins in same PDB: d4dhna2
    automated match to d3p1oa_
    complexed with 0kc, cl, gol, mg

Details for d4dhna1

PDB Entry: 4dhn (more details), 1.8 Å

PDB Description: Small-molecule inhibitors of 14-3-3 protein-protein interactions from virtual screening
PDB Compounds: (A:) 14-3-3 protein sigma

SCOPe Domain Sequences for d4dhna1:

Sequence, based on SEQRES records: (download)

>d4dhna1 a.118.7.1 (A:1-231) automated matches {Human (Homo sapiens) [TaxId: 9606]}
merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr
vlssieqksneegseekgpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfy
lkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfh
yeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

Sequence, based on observed residues (ATOM records): (download)

>d4dhna1 a.118.7.1 (A:1-231) automated matches {Human (Homo sapiens) [TaxId: 9606]}
merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr
vlssieqksngpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfylkmkgdy
yrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfhyeiansp
eeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwt

SCOPe Domain Coordinates for d4dhna1:

Click to download the PDB-style file with coordinates for d4dhna1.
(The format of our PDB-style files is described here.)

Timeline for d4dhna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4dhna2