![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
![]() | Protein Hemagglutinin [49824] (22 species) includes rudiment esterase domain |
![]() | Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries) |
![]() | Domain d4kdoc1: 4kdo C:5-325 [227561] Other proteins in same PDB: d4kdoa2, d4kdob_, d4kdoc2, d4kdod_, d4kdoe2, d4kdof_ automated match to d4kpsa_ complexed with nag, sia |
PDB Entry: 4kdo (more details), 2.4 Å
SCOPe Domain Sequences for d4kdoc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kdoc1 b.19.1.2 (C:5-325) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]} dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks swssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwgihh pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpndain fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig ecpkyvksnrlvlaiglrnsp
Timeline for d4kdoc1: