Lineage for d3pceo_ (3pce O:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1772695Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1773641Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 1773642Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 1773851Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 1773866Species Pseudomonas putida [TaxId:303] [49490] (36 PDB entries)
  8. 1773938Domain d3pceo_: 3pce O: [22756]
    Other proteins in same PDB: d3pcea_, d3pceb_, d3pcec_, d3pced_, d3pcee_, d3pcef_
    complexed with 3hp, bme, fe

Details for d3pceo_

PDB Entry: 3pce (more details), 2.06 Å

PDB Description: structure of protocatechuate 3,4-dioxygenase complexed with 3- hydroxyphenylacetate
PDB Compounds: (O:) protocatechuate 3,4-dioxygenase

SCOPe Domain Sequences for d3pceo_:

Sequence, based on SEQRES records: (download)

>d3pceo_ b.3.6.1 (O:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

Sequence, based on observed residues (ATOM records): (download)

>d3pceo_ b.3.6.1 (O:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapldpnf
ggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyfegd
plipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

SCOPe Domain Coordinates for d3pceo_:

Click to download the PDB-style file with coordinates for d3pceo_.
(The format of our PDB-style files is described here.)

Timeline for d3pceo_: