Lineage for d4kdme1 (4kdm E:5-325)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2047495Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2047496Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2047543Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2047544Protein Hemagglutinin [49824] (9 species)
    includes rudiment esterase domain
  7. 2047584Species Influenza A virus, different strains [TaxId:11320] [49825] (116 PDB entries)
  8. 2047773Domain d4kdme1: 4kdm E:5-325 [227554]
    Other proteins in same PDB: d4kdma2, d4kdmb_, d4kdmc2, d4kdmd_, d4kdme2, d4kdmf_
    automated match to d4kpsa_
    complexed with nag

Details for d4kdme1

PDB Entry: 4kdm (more details), 2.5 Å

PDB Description: crystal structure of the hemagglutinin of ferret-transmissible h5n1 virus
PDB Compounds: (E:) Hemagglutinin

SCOPe Domain Sequences for d4kdme1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kdme1 b.19.1.2 (E:5-325) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dqicigyhannsteqvdtimeknvtvthaqdilekkhngklcdldgvkplilrdcsvagw
llgnpmcdefinvpewsyivekanpvndlcypgdfndyeelkhllsrinhfekiqiipks
swssheaslgvssacpyqgkssffrnvvwlikkdstyptikrsynntnqedllvlwgihh
pndaaeqtklyqnpttyisvgtstlnqrlvpriatrskvkglsgrmeffwtilkpndain
fesngnfiapeyaykivkkgdstimkseleygncntkcqtpmgainssmpfhnihpltig
ecpkyvksnrlvlaiglrnsp

SCOPe Domain Coordinates for d4kdme1:

Click to download the PDB-style file with coordinates for d4kdme1.
(The format of our PDB-style files is described here.)

Timeline for d4kdme1: