Lineage for d4jycc_ (4jyc C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869013Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2869206Protein Metallochaperone MeaB [159564] (1 species)
    ArgK-like (sub)family; Pfam PF03308
  7. 2869207Species Methylobacterium extorquens [TaxId:408] [159565] (5 PDB entries)
    Uniprot Q8RPA0 5-327
  8. 2869216Domain d4jycc_: 4jyc C: [227549]
    automated match to d2qm8a_
    complexed with gdp

    has additional insertions and/or extensions that are not grouped together

Details for d4jycc_

PDB Entry: 4jyc (more details), 2.2 Å

PDB Description: MeaB, A Bacterial Homolog of MMAA, in its Apo form
PDB Compounds: (C:) Methylmalonyl-CoA mutase accessory protein

SCOPe Domain Sequences for d4jycc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jycc_ c.37.1.10 (C:) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]}
pdmdtlrerllagdraalaraitlaesrradhraavrdlidavlpqtgrairvgitgvpg
vgksttidalgslltaaghkvavlavdpsstrtggsilgdktrmarlaidrnafirpsps
sgtlggvaaktretmllceaagfdvilvetvgvgqsetavadltdfflvlmlpgagdelq
gikkgifeladmiavnkaddgdgerrasaaaseyraalhiltppsatwtppvvtisglhg
kgldslwsriedhrskltatgeiagkrreqdvkwmwalvherlhqrlvgsaevrqataea
eravaggehspaagadaiatligl

SCOPe Domain Coordinates for d4jycc_:

Click to download the PDB-style file with coordinates for d4jycc_.
(The format of our PDB-style files is described here.)

Timeline for d4jycc_: