Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries) |
Domain d4l4vd2: 4l4v D:111-200 [227541] Other proteins in same PDB: d4l4vd1, d4l4ve1, d4l4ve2, d4l4vg1, d4l4vh1, d4l4vh2 automated match to d2f54d2 complexed with 1vy, gol |
PDB Entry: 4l4v (more details), 1.9 Å
SCOPe Domain Sequences for d4l4vd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l4vd2 b.1.1.2 (D:111-200) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffpsp
Timeline for d4l4vd2: