Lineage for d4l4vh2 (4l4v H:117-242)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765318Domain d4l4vh2: 4l4v H:117-242 [227539]
    Other proteins in same PDB: d4l4va1, d4l4vb_, d4l4vc1, d4l4vd2, d4l4vf_, d4l4vg2
    automated match to d2nw2b2
    complexed with 1vy, gol

Details for d4l4vh2

PDB Entry: 4l4v (more details), 1.9 Å

PDB Description: Structure of human MAIT TCR in complex with human MR1-RL-6-Me-7-OH
PDB Compounds: (H:) MAIT T-cell receptor beta chain

SCOPe Domain Sequences for d4l4vh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l4vh2 b.1.1.0 (H:117-242) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawg

SCOPe Domain Coordinates for d4l4vh2:

Click to download the PDB-style file with coordinates for d4l4vh2.
(The format of our PDB-style files is described here.)

Timeline for d4l4vh2: