SCOPe 2.08: Domain d4l4vh2: 4l4v H:117-242

Lineage for d4l4vh2 (4l4v H:117-242)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4l4vh2: 4l4v H:117-242 [227539]
   Other proteins in same PDB: d4l4va1, d4l4vb_, d4l4vc1, d4l4vc3, d4l4vd2, d4l4vf_, d4l4vg2
   automated match to d2nw2b2
   complexed with 1vy, gol

Details for d4l4vh2

PDB Entry: 4l4v, 1.9 Å

PDB Description: Structure of human MAIT TCR in complex with human MR1-RL-6-Me-7-OH

PDB Compounds: (H:) MAIT T-cell receptor beta chain

SCOPe Domain Sequences for d4l4vh2:

Sequence; same for both SEQRES and ATOM records:

>d4l4vh2 b.1.1.0 (H:117-242) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawg

Timeline for d4l4vh2:

• d4l4vh2 first appeared in SCOPe 2.03
  
• d4l4vh2 appears in SCOPe 2.07