Lineage for d4kx6n2 (4kx6 N:106-243)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2689591Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 2689592Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)
  6. 2689593Protein Fumarate reductase [46550] (3 species)
  7. 2689597Species Escherichia coli [TaxId:562] [46551] (6 PDB entries)
  8. 2689603Domain d4kx6n2: 4kx6 N:106-243 [227536]
    Other proteins in same PDB: d4kx6b1, d4kx6c_, d4kx6d_, d4kx6n1, d4kx6o_, d4kx6p_
    automated match to d1kf6b1
    complexed with f3s, fad, fes, mq7, sf4

Details for d4kx6n2

PDB Entry: 4kx6 (more details), 2.95 Å

PDB Description: plasticity of the quinone-binding site of the complex ii homolog quinol:fumarate reductase
PDB Compounds: (N:) Fumarate reductase (Anaerobic), Fe-S subunit

SCOPe Domain Sequences for d4kx6n2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kx6n2 a.1.2.1 (N:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]}
mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp
efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq
qgkvesskdfliatlkpr

SCOPe Domain Coordinates for d4kx6n2:

Click to download the PDB-style file with coordinates for d4kx6n2.
(The format of our PDB-style files is described here.)

Timeline for d4kx6n2: