| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) ![]() contains two Fe4-S4 clusters |
| Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) |
| Protein Fumarate reductase [46550] (3 species) |
| Species Escherichia coli [TaxId:562] [46551] (6 PDB entries) |
| Domain d4kx6b2: 4kx6 B:106-243 [227535] Other proteins in same PDB: d4kx6b1, d4kx6c_, d4kx6d_, d4kx6n1, d4kx6o_, d4kx6p_ automated match to d1kf6b1 complexed with f3s, fad, fes, mq7, sf4 |
PDB Entry: 4kx6 (more details), 2.95 Å
SCOPe Domain Sequences for d4kx6b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4kx6b2 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]}
mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp
efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq
qgkvesskdfliatlkpr
Timeline for d4kx6b2: