| Class g: Small proteins [56992] (90 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
| Family g.3.11.1: EGF-type module [57197] (23 proteins) |
| Protein automated matches [190092] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187310] (65 PDB entries) |
| Domain d4jyvl_: 4jyv L: [227533] Other proteins in same PDB: d4jyvh_ automated match to d1w7xl_ complexed with 1oj, ca, gol, so4 |
PDB Entry: 4jyv (more details), 2.19 Å
SCOPe Domain Sequences for d4jyvl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jyvl_ g.3.11.1 (L:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekr
Timeline for d4jyvl_: