Lineage for d4l4ve1 (4l4v E:2-116)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295971Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)
  8. 1296070Domain d4l4ve1: 4l4v E:2-116 [227532]
    Other proteins in same PDB: d4l4vd2, d4l4vg2
    automated match to d2nw2b1
    complexed with 1vy, gol

Details for d4l4ve1

PDB Entry: 4l4v (more details), 1.9 Å

PDB Description: Structure of human MAIT TCR in complex with human MR1-RL-6-Me-7-OH
PDB Compounds: (E:) MAIT T-cell receptor beta chain

SCOPe Domain Sequences for d4l4ve1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l4ve1 b.1.1.0 (E:2-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevp
ngynvsrlnkrefslrlesaapsqtsvyfcassvwtgegsgelffgegsrltvle

SCOPe Domain Coordinates for d4l4ve1:

Click to download the PDB-style file with coordinates for d4l4ve1.
(The format of our PDB-style files is described here.)

Timeline for d4l4ve1: