![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
![]() | Domain d4l4vh1: 4l4v H:3-116 [227531] Other proteins in same PDB: d4l4va1, d4l4vb_, d4l4vc1, d4l4vc3, d4l4vd2, d4l4vf_, d4l4vg2 automated match to d2nw2b1 complexed with 1vy, gol |
PDB Entry: 4l4v (more details), 1.9 Å
SCOPe Domain Sequences for d4l4vh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l4vh1 b.1.1.0 (H:3-116) automated matches {Human (Homo sapiens) [TaxId: 9606]} gvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevpn gynvsrlnkrefslrlesaapsqtsvyfcassvwtgegsgelffgegsrltvle
Timeline for d4l4vh1: