SCOPe 2.08: Domain d4l4te1: 4l4t E:2-116

Lineage for d4l4te1 (4l4t E:2-116)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4l4te1: 4l4t E:2-116 [227530]
   Other proteins in same PDB: d4l4ta1, d4l4ta3, d4l4tb_, d4l4tc1, d4l4tc3, d4l4td2, d4l4tf_, d4l4tg2
   automated match to d2nw2b1
   complexed with 6fp

Details for d4l4te1

PDB Entry: 4l4t, 2 Å

PDB Description: Structure of human MAIT TCR in complex with human MR1-6-FP

PDB Compounds: (E:) MAIT T-cell receptor beta chain

SCOPe Domain Sequences for d4l4te1:

Sequence; same for both SEQRES and ATOM records:

>d4l4te1 b.1.1.0 (E:2-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agvtqtpkfqvlktgqsmtlqcaqdmnhnsmywyrqdpgmglrliyysasegttdkgevp
ngynvsrlnkrefslrlesaapsqtsvyfcassvwtgegsgelffgegsrltvle

Timeline for d4l4te1:

• d4l4te1 first appeared in SCOPe 2.03
  
• d4l4te1 appears in SCOPe 2.07