Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (7 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d4l4tf_: 4l4t F: [227526] Other proteins in same PDB: d4l4ta1, d4l4ta2, d4l4ta3, d4l4tc1, d4l4tc2, d4l4tc3, d4l4td1, d4l4td2, d4l4te1, d4l4te2, d4l4tg1, d4l4tg2, d4l4th1, d4l4th2 automated match to d1xh3b_ complexed with 6fp |
PDB Entry: 4l4t (more details), 2 Å
SCOPe Domain Sequences for d4l4tf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l4tf_ b.1.1.2 (F:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdr
Timeline for d4l4tf_: