SCOPe 2.08: Domain d4kx6n1: 4kx6 N:1-105

Lineage for d4kx6n1 (4kx6 N:1-105)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families)

5. Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)

6. Protein Fumarate reductase iron-sulfur protein, N-terminal domain [54325] (3 species)

7. Species Escherichia coli [TaxId:562] [54326] (6 PDB entries)

8. Domain d4kx6n1: 4kx6 N:1-105 [227519]
   Other proteins in same PDB: d4kx6b2, d4kx6c_, d4kx6d_, d4kx6n2, d4kx6o_, d4kx6p_
   automated match to d1kf6b2
   complexed with f3s, fad, fes, mq7, sf4

Details for d4kx6n1

PDB Entry: 4kx6, 2.95 Å

PDB Description: plasticity of the quinone-binding site of the complex ii homolog quinol:fumarate reductase

PDB Compounds: (N:) Fumarate reductase (Anaerobic), Fe-S subunit

SCOPe Domain Sequences for d4kx6n1:

Sequence; same for both SEQRES and ATOM records:

>d4kx6n1 d.15.4.2 (N:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]}
aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma
icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvd

Timeline for d4kx6n1:

• d4kx6n1 first appeared in SCOPe 2.03
  
• d4kx6n1 appears in SCOPe 2.07