Lineage for d4kx6n1 (4kx6 N:1-105)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933988Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2934046Protein Fumarate reductase iron-sulfur protein, N-terminal domain [54325] (3 species)
  7. 2934050Species Escherichia coli [TaxId:562] [54326] (6 PDB entries)
  8. 2934056Domain d4kx6n1: 4kx6 N:1-105 [227519]
    Other proteins in same PDB: d4kx6b2, d4kx6c_, d4kx6d_, d4kx6n2, d4kx6o_, d4kx6p_
    automated match to d1kf6b2
    complexed with f3s, fad, fes, mq7, sf4

Details for d4kx6n1

PDB Entry: 4kx6 (more details), 2.95 Å

PDB Description: plasticity of the quinone-binding site of the complex ii homolog quinol:fumarate reductase
PDB Compounds: (N:) Fumarate reductase (Anaerobic), Fe-S subunit

SCOPe Domain Sequences for d4kx6n1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kx6n1 d.15.4.2 (N:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]}
aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma
icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvd

SCOPe Domain Coordinates for d4kx6n1:

Click to download the PDB-style file with coordinates for d4kx6n1.
(The format of our PDB-style files is described here.)

Timeline for d4kx6n1: