Lineage for d4kx6c_ (4kx6 C:)

  1. Root: SCOPe 2.07
  2. 2575216Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2577736Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 2577828Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 2577848Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
    consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups
  6. 2577849Protein Fumarate reductase subunit FrdC [81370] (2 species)
  7. 2577850Species Escherichia coli [TaxId:536056] [224948] (2 PDB entries)
  8. 2577851Domain d4kx6c_: 4kx6 C: [227517]
    Other proteins in same PDB: d4kx6b1, d4kx6b2, d4kx6d_, d4kx6n1, d4kx6n2, d4kx6p_
    automated match to d3p4pc_
    complexed with f3s, fad, fes, mq7, sf4

Details for d4kx6c_

PDB Entry: 4kx6 (more details), 2.95 Å

PDB Description: Plasticity of the quinone-binding site of the complex II homolog quinol:fumarate reductase
PDB Compounds: (C:) Fumarate reductase subunit C

SCOPe Domain Sequences for d4kx6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kx6c_ f.21.2.2 (C:) Fumarate reductase subunit FrdC {Escherichia coli [TaxId: 536056]}
ttkrkpyvrpmtstwwkklpfyrfymlrlgtavpavwfsielifglfalkngpeawagfv
dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat
ivilfvalyw

SCOPe Domain Coordinates for d4kx6c_:

Click to download the PDB-style file with coordinates for d4kx6c_.
(The format of our PDB-style files is described here.)

Timeline for d4kx6c_: