Lineage for d4kx6p_ (4kx6 P:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024525Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 3024622Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 3024642Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins)
    consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups
  6. 3024660Protein Fumarate reductase subunit FrdD [81372] (2 species)
  7. 3024664Species Escherichia coli [TaxId:562] [81371] (6 PDB entries)
    is not known to bind heme
  8. 3024670Domain d4kx6p_: 4kx6 P: [227516]
    Other proteins in same PDB: d4kx6b1, d4kx6b2, d4kx6c_, d4kx6n1, d4kx6n2, d4kx6o_
    automated match to d1kf6d_
    complexed with f3s, fad, fes, mq7, sf4

Details for d4kx6p_

PDB Entry: 4kx6 (more details), 2.95 Å

PDB Description: plasticity of the quinone-binding site of the complex ii homolog quinol:fumarate reductase
PDB Compounds: (P:) Fumarate reductase subunit D

SCOPe Domain Sequences for d4kx6p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4kx6p_ f.21.2.2 (P:) Fumarate reductase subunit FrdD {Escherichia coli [TaxId: 562]}
minpnpkrsdepvfwglfgaggmwsaiiapvmillvgillplglfpgdalsyervlafaq
sfigrvflflmivlplwcglhrmhhamhdlkihvpagkwvfyglaailtvvtligvvti

SCOPe Domain Coordinates for d4kx6p_:

Click to download the PDB-style file with coordinates for d4kx6p_.
(The format of our PDB-style files is described here.)

Timeline for d4kx6p_: