SCOPe 2.03: Domain d4kx6d_: 4kx6 D:

Lineage for d4kx6d_ (4kx6 D:)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families)
   two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains

5. Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (4 proteins)
   consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups

6. Protein Fumarate reductase subunit FrdD [81372] (2 species)

7. Species Escherichia coli [TaxId:562] [81371] (6 PDB entries)
   is not known to bind heme

8. Domain d4kx6d_: 4kx6 D: [227515]
   Other proteins in same PDB: d4kx6c_, d4kx6n1, d4kx6n2, d4kx6o_
   automated match to d1kf6d_
   complexed with f3s, fad, fes, mq7, sf4

Details for d4kx6d_

PDB Entry: 4kx6, 2.95 Å

PDB Description: plasticity of the quinone-binding site of the complex ii homolog quinol:fumarate reductase

PDB Compounds: (D:) Fumarate reductase subunit D

SCOPe Domain Sequences for d4kx6d_:

Sequence; same for both SEQRES and ATOM records:

>d4kx6d_ f.21.2.2 (D:) Fumarate reductase subunit FrdD {Escherichia coli [TaxId: 562]}
minpnpkrsdepvfwglfgaggmwsaiiapvmillvgillplglfpgdalsyervlafaq
sfigrvflflmivlplwcglhrmhhamhdlkihvpagkwvfyglaailtvvtligvvti

Timeline for d4kx6d_:

• d4kx6d_ is new in SCOPe 2.03-stable
  
• d4kx6d_ appears in SCOPe 2.04
  
• d4kx6d_ appears in the current release, SCOPe 2.08