Lineage for d4j56h1 (4j56 H:2-104)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876194Protein Thioredoxin [52835] (16 species)
  7. 2876400Species Plasmodium falciparum [TaxId:36329] [227500] (4 PDB entries)
  8. 2876404Domain d4j56h1: 4j56 H:2-104 [227507]
    Other proteins in same PDB: d4j56e2, d4j56f2, d4j56g2, d4j56h2
    automated match to d1ep7a_
    complexed with fad

Details for d4j56h1

PDB Entry: 4j56 (more details), 2.37 Å

PDB Description: Structure of Plasmodium falciparum thioredoxin reductase-thioredoxin complex
PDB Compounds: (H:) thioredoxin

SCOPe Domain Sequences for d4j56h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j56h1 c.47.1.1 (H:2-104) Thioredoxin {Plasmodium falciparum [TaxId: 36329]}
vkivtsqaefdsiisqnelvivdffaewcgpskriapfyeecsktytkmvfikvdvdevs
evtekenitsmptfkvykngssvdtllgandsalkqliekyaa

SCOPe Domain Coordinates for d4j56h1:

Click to download the PDB-style file with coordinates for d4j56h1.
(The format of our PDB-style files is described here.)

Timeline for d4j56h1: